PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_101972g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 328aa    MW: 35753.8 Da    PI: 9.52
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_101972g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.63.1e-33123177358
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                     +v+Y+eClkNhAas+Ggha DGCgEfmps g+egt +alkCaACgCHRnFHRr+++
  MA_101972g0010 123 SVKYRECLKNHAASIGGHANDGCGEFMPS-GDEGTLEALKCAACGCHRNFHRRDTN 177
                     699*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-20119177IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.9E-30124176IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.5E-30125175IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.752126175IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466897.17E-18259326IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-31259327IPR009057Homeodomain-like
TIGRFAMsTIGR015653.6E-26265321IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MTTRAGRRRR HVAVRVVSRS RFLTCRQWNL GLGVRTAEVR SFWVLELLME MGAGGNEAEI  60
GMPMSVSYGH MAAAHAQIHE ANSKPNNSNM GADNCSTASD QEIRPLSHEA AAAAGVSLAK  120
PRSVKYRECL KNHAASIGGH ANDGCGEFMP SGDEGTLEAL KCAACGCHRN FHRRDTNNGG  180
GDPSASCYYC CYASNGNGSS KRPGGLHLPV PAPHVPLALP SSPSGITRSH PQMIMAIRDV  240
GGEDHDHMMS GAGAHAMYMA GHAMKKRFRT KFTQEQKDKM CAFAEKLGWR IQKHDDLAVQ  300
QFCMDVGVKR HVLKVWMHNN KHTLAKKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-272663231875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1232160.0BT123216.1 Picea sitchensis clone WS04710_D24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9SB613e-61ZHD2_ARATH; Zinc-finger homeodomain protein 2
SwissprotQ6YXH56e-61ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
SwissprotA2Z2598e-61ZHD1_ORYSI; Zinc-finger homeodomain protein 1
TrEMBLD5AAI20.0D5AAI2_PICSI; Putative uncharacterized protein
STRINGVIT_18s0001g07140.t013e-67(Vitis vinifera)
STRINGPP1S3_539V6.12e-66(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.16e-59homeobox protein 22